SCOPe 2.07: Domain d1rlra1: 1rlr A:10-221

Lineage for d1rlra1 (1rlr A:10-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Escherichia coli [TaxId:562] [48171] (10 PDB entries)
   Uniprot Q08698

8. Domain d1rlra1: 1rlr A:10-221 [18753]
   Other proteins in same PDB: d1rlra2

Details for d1rlra1

PDB Entry: 1rlr, 2.5 Å

PDB Description: structure of ribonucleotide reductase protein r1

PDB Compounds: (A:) ribonucleotide reductase protein r1

SCOPe Domain Sequences for d1rlra1:

Sequence; same for both SEQRES and ATOM records:

>d1rlra1 a.98.1.1 (A:10-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
rdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiikaaadl
isrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyteeefk
qmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsnypretr
lqyvkrfydavstfkislptpimsgvrtptrq

Timeline for d1rlra1:

• d1rlra1 first appeared (with stable ids) in SCOP 1.55, called d1rlr_1
  
• d1rlra1 appears in SCOPe 2.06