![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
![]() | Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
![]() | Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
![]() | Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [48171] (10 PDB entries) Uniprot Q08698 |
![]() | Domain d1rlra1: 1rlr A:10-221 [18753] Other proteins in same PDB: d1rlra2 |
PDB Entry: 1rlr (more details), 2.5 Å
SCOPe Domain Sequences for d1rlra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlra1 a.98.1.1 (A:10-221) R1 subunit of ribonucleotide reductase, N-terminal domain {Escherichia coli [TaxId: 562]} rdgsterinldkihrvldwaaeglhnvsisqvelrshiqfydgiktsdihetiikaaadl isrdapdyqylaarlaifhlrkkaygqfeppalydhvvkmvemgkydnhlledyteeefk qmdtfidhdrdmtfsyaavkqlegkylvqnrvtgeiyesaqflyilvaaclfsnypretr lqyvkrfydavstfkislptpimsgvrtptrq
Timeline for d1rlra1: