Lineage for d3atjb_ (3atj B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) 
Family a.93.1.1: CCP-like [48114] (6 proteins) Protein Plant peroxidase [48125] (6 species) 
Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (21 PDB entries) 
Domain d3atjb_: 3atj B: [18678]
Details for d3atjb_
PDB Entry: 3atj (more details), 2.2 Å
PDB Description: heme ligand mutant of recombinant horseradish peroxidase in complex with benzhydroxamic acid
SCOP Domain Sequences for d3atjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3atjb_ a.93.1.1 (B:) Plant peroxidase {Horseradish (Armoracia rusticana)}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn
SCOP Domain Coordinates for d3atjb_:
Click to download the PDB-style file with coordinates for d3atjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3atjb_:
- d3atjb_ first appeared (with stable ids) in SCOP 1.55
- d3atjb_ appears in SCOP 1.59
- d3atjb_ appears in SCOP 1.63
- d3atjb_ appears in the current release, SCOPe 2.08, called d3atjb1
View in 3D
