Lineage for d3atjb1 (3atj B:1-307)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2328533Protein Plant peroxidase [48125] (6 species)
  7. 2328536Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2328565Domain d3atjb1: 3atj B:1-307 [18678]
    Other proteins in same PDB: d3atja2, d3atjb2
    complexed with bho, ca, hem; mutant

Details for d3atjb1

PDB Entry: 3atj (more details), 2.2 Å

PDB Description: heme ligand mutant of recombinant horseradish peroxidase in complex with benzhydroxamic acid
PDB Compounds: (B:) protein (horseradish peroxidase c1a)

SCOPe Domain Sequences for d3atjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atjb1 a.93.1.1 (B:1-307) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvnsn

SCOPe Domain Coordinates for d3atjb1:

Click to download the PDB-style file with coordinates for d3atjb1.
(The format of our PDB-style files is described here.)

Timeline for d3atjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3atjb2