SCOPe 2.08: Domain d3atjb1: 3atj B:1-307

Lineage for d3atjb1 (3atj B:1-307)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Plant peroxidase [48125] (6 species)

7. Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)

8. Domain d3atjb1: 3atj B:1-307 [18678]
   Other proteins in same PDB: d3atja2, d3atjb2
   complexed with bho, ca, hem; mutant

Details for d3atjb1

PDB Entry: 3atj, 2.2 Å

PDB Description: heme ligand mutant of recombinant horseradish peroxidase in complex with benzhydroxamic acid

PDB Compounds: (B:) protein (horseradish peroxidase c1a)

SCOPe Domain Sequences for d3atjb1:

Sequence; same for both SEQRES and ATOM records:

>d3atjb1 a.93.1.1 (B:1-307) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvnsn

Timeline for d3atjb1:

• d3atjb1 first appeared (with stable ids) in SCOP 1.55, called d3atjb_
  
• d3atjb1 appears in SCOPe 2.07