Lineage for d3atjb_ (3atj B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99645Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 99646Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 99647Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 99761Protein Plant peroxidase [48125] (6 species)
  7. 99764Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (5 PDB entries)
  8. 99770Domain d3atjb_: 3atj B: [18678]

Details for d3atjb_

PDB Entry: 3atj (more details), 2.2 Å

PDB Description: heme ligand mutant of recombinant horseradish peroxidase in complex with benzhydroxamic acid

SCOP Domain Sequences for d3atjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3atjb_ a.93.1.1 (B:) Plant peroxidase {Horseradish (Armoracia rusticana)}
mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnlee
qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
ncrvvnsn

SCOP Domain Coordinates for d3atjb_:

Click to download the PDB-style file with coordinates for d3atjb_.
(The format of our PDB-style files is described here.)

Timeline for d3atjb_: