Lineage for d4a49b_ (4a49 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939164Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (31 PDB entries)
    Uniprot P62837
    E2-17 kDa 2
  8. 2939190Domain d4a49b_: 4a49 B: [186719]
    automated match to d1ur6a_
    complexed with k, zn

Details for d4a49b_

PDB Entry: 4a49 (more details), 2.21 Å

PDB Description: structure of phosphotyr371-c-cbl-ubch5b complex
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d4a49b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a49b_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
alkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d4a49b_:

Click to download the PDB-style file with coordinates for d4a49b_.
(The format of our PDB-style files is described here.)

Timeline for d4a49b_: