SCOPe 2.04: Domain d3v2ka_: 3v2k A:

Lineage for d3v2ka_ (3v2k A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (55 PDB entries)

8. Domain d3v2ka_: 3v2k A: [186456]
   automated match to d1ahaa_
   protein/RNA complex; complexed with ade, gol, nag

Details for d3v2ka_

PDB Entry: 3v2k, 2.07 Å

PDB Description: crystal structure of ribosome inactivating protein from momordica balsamina complexed with the product of rna substrate adenosine triphosphate at 2.0 a resolution

PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3v2ka_:

Sequence; same for both SEQRES and ATOM records:

>d3v2ka_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d3v2ka_:

• d3v2ka_ first appeared in SCOPe 2.01
  
• d3v2ka_ appears in SCOPe 2.03
  
• d3v2ka_ appears in SCOPe 2.05
  
• d3v2ka_ appears in the current release, SCOPe 2.08