Lineage for d3tcff_ (3tcf F:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008597Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1008598Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1008599Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1009303Protein automated matches [190140] (10 species)
    not a true protein
  7. 1009316Species Escherichia coli K-12 [TaxId:83333] [189211] (9 PDB entries)
  8. 1009338Domain d3tcff_: 3tcf F: [185753]
    automated match to d1b05a_

Details for d3tcff_

PDB Entry: 3tcf (more details), 2 Å

PDB Description: crystal structure of e. coli oppa complexed with endogenous ligands
PDB Compounds: (F:) periplasmic oligopeptide-binding protein

SCOPe Domain Sequences for d3tcff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tcff_ c.94.1.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
advpagvtlaekqtlvrnngsevqsldphkiegvpesnisrdlfegllvsdldghpapgv
aeswdnkdakvwtfhlrkdakwsdgtpvtaqdfvyswqrsvdpntaspyasylqyghiag
ideilegkkpitdlgvkaiddhtlevtlsepvpyfykllvhpstspvpkaaiekfgekwt
qpgnivtngaytlkdwvvnerivlersptywnnaktvinqvtylpiasevtdvnryrsge
idmtnnsmpielfqklkkeipdevhvdpylctyyyeinnqkppfndvrvrtalklgmdrd
iivnkvkaqgnmpaygytppytdgakltqpewfgwsqekrneeakkllaeagytadkplt
inllyntsdlhkklaiaasslwkknigvnvklvnqewktfldtrhqgtfdvaragwcady
neptsflntmlsnssmntahykspafdsimaetlkvtdeaqrtalytkaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldntytrnmyivkh

SCOPe Domain Coordinates for d3tcff_:

Click to download the PDB-style file with coordinates for d3tcff_.
(The format of our PDB-style files is described here.)

Timeline for d3tcff_: