SCOPe 2.01: Domain d3tcfe_: 3tcf E:

Lineage for d3tcfe_ (3tcf E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189211] (9 PDB entries)

8. Domain d3tcfe_: 3tcf E: [185752]
   automated match to d1b05a_

Details for d3tcfe_

PDB Entry: 3tcf, 2 Å

PDB Description: crystal structure of e. coli oppa complexed with endogenous ligands

PDB Compounds: (E:) periplasmic oligopeptide-binding protein

SCOPe Domain Sequences for d3tcfe_:

Sequence; same for both SEQRES and ATOM records:

>d3tcfe_ c.94.1.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
advpagvtlaekqtlvrnngsevqsldphkiegvpesnisrdlfegllvsdldghpapgv
aeswdnkdakvwtfhlrkdakwsdgtpvtaqdfvyswqrsvdpntaspyasylqyghiag
ideilegkkpitdlgvkaiddhtlevtlsepvpyfykllvhpstspvpkaaiekfgekwt
qpgnivtngaytlkdwvvnerivlersptywnnaktvinqvtylpiasevtdvnryrsge
idmtnnsmpielfqklkkeipdevhvdpylctyyyeinnqkppfndvrvrtalklgmdrd
iivnkvkaqgnmpaygytppytdgakltqpewfgwsqekrneeakkllaeagytadkplt
inllyntsdlhkklaiaasslwkknigvnvklvnqewktfldtrhqgtfdvaragwcady
neptsflntmlsnssmntahykspafdsimaetlkvtdeaqrtalytkaeqqldkdsaiv
pvyyyvnarlvkpwvggytgkdpldntytrnmyivkh

Timeline for d3tcfe_:

• d3tcfe_ is new in SCOPe 2.01-stable
  
• d3tcfe_ appears in SCOPe 2.02
  
• d3tcfe_ appears in the current release, SCOPe 2.08