SCOPe 2.08: Domain d1c3oc1: 1c3o C:403-555

Lineage for d1c3oc1 (1c3o C:403-555)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   possible duplication: subdomains have similar topologies

4. Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family)
   automatically mapped to Pfam PF02787

5. Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)

6. Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)

7. Species Escherichia coli [TaxId:562] [48111] (10 PDB entries)
   Uniprot P00968

8. Domain d1c3oc1: 1c3o C:403-555 [18563]
   Other proteins in same PDB: d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2
   complexed with adp, cl, gln, k, mn, net, orn, po4; mutant

Details for d1c3oc1

PDB Entry: 1c3o, 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

PDB Compounds: (C:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c3oc1:

Sequence; same for both SEQRES and ATOM records:

>d1c3oc1 a.92.1.1 (C:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli [TaxId: 562]}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

Timeline for d1c3oc1:

• d1c3oc1 first appeared (with stable ids) in SCOP 1.55
  
• d1c3oc1 appears in SCOPe 2.07