SCOPe 2.08: Domain d1c3oc3: 1c3o C:1-127

Lineage for d1c3oc3 (1c3o C:1-127)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
   duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains

7. Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
   Uniprot P00968

8. Domain d1c3oc3: 1c3o C:1-127 [31683]
   Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2
   complexed with adp, cl, gln, k, mn, net, orn, po4; mutant

Details for d1c3oc3

PDB Entry: 1c3o, 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

PDB Compounds: (C:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c3oc3:

Sequence; same for both SEQRES and ATOM records:

>d1c3oc3 c.30.1.1 (C:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1c3oc3:

• d1c3oc3 first appeared (with stable ids) in SCOP 1.55
  
• d1c3oc3 appears in SCOPe 2.07