Lineage for d1c3oa3 (1c3o A:1-127)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2861935Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 2861936Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
    Uniprot P00968
  8. 2861993Domain d1c3oa3: 1c3o A:1-127 [31681]
    Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og2, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2
    complexed with adp, cl, gln, k, mn, net, orn, po4; mutant

Details for d1c3oa3

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine
PDB Compounds: (A:) carbamoyl phosphate synthetase: large subunit

SCOPe Domain Sequences for d1c3oa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3oa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

SCOPe Domain Coordinates for d1c3oa3:

Click to download the PDB-style file with coordinates for d1c3oa3.
(The format of our PDB-style files is described here.)

Timeline for d1c3oa3: