Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein Peptide deformylase [56422] (11 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (10 PDB entries) |
Domain d3strp_: 3str P: [185561] automated match to d1lm6a_ complexed with 3li, gol, ni, so4 |
PDB Entry: 3str (more details), 1.75 Å
SCOPe Domain Sequences for d3strp_:
Sequence, based on SEQRES records: (download)
>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi mfydrinekdpfavkdgllile
>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm aekmglrggvglaapqldiskriiavlvpniaydleaimynpkivshsvqdaalgegegc lsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrinek dpfavkdgllile
Timeline for d3strp_: