Lineage for d3strp_ (3str P:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606955Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (10 PDB entries)
  8. 2606963Domain d3strp_: 3str P: [185561]
    automated match to d1lm6a_
    complexed with 3li, gol, ni, so4

Details for d3strp_

PDB Entry: 3str (more details), 1.75 Å

PDB Description: Strep Peptide Deformylase with a time dependent thiazolidine hydroxamic acid
PDB Compounds: (P:) Peptide deformylase 3

SCOPe Domain Sequences for d3strp_:

Sequence, based on SEQRES records: (download)

>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd
aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi
mfydrinekdpfavkdgllile

Sequence, based on observed residues (ATOM records): (download)

>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniaydleaimynpkivshsvqdaalgegegc
lsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrinek
dpfavkdgllile

SCOPe Domain Coordinates for d3strp_:

Click to download the PDB-style file with coordinates for d3strp_.
(The format of our PDB-style files is described here.)

Timeline for d3strp_: