SCOPe 2.01: Domain d3strp_: 3str P:

Lineage for d3strp_ (3str P:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)

6. Protein Peptide deformylase [56422] (10 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [90057] (7 PDB entries)

8. Domain d3strp_: 3str P: [185561]
   automated match to d1lm6a_
   complexed with 3li, gol, ni, so4

Details for d3strp_

PDB Entry: 3str, 1.75 Å

PDB Description: Strep Peptide Deformylase with a time dependent thiazolidine hydroxamic acid

PDB Compounds: (P:) Peptide deformylase 3

SCOPe Domain Sequences for d3strp_:

Sequence, based on SEQRES records:

>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniveegetpqeaydleaimynpkivshsvqd
aalgegegclsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingi
mfydrinekdpfavkdgllile

Sequence, based on observed residues (ATOM records):

>d3strp_ d.167.1.1 (P:) Peptide deformylase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
saieritkaahlidmndiiregnptlrtvaeevtfplsdqeiilgekmmqflkhsqdpvm
aekmglrggvglaapqldiskriiavlvpniaydleaimynpkivshsvqdaalgegegc
lsvdrnvpgyvvrharvtvdyfdkdgekhriklkgynsivvqheidhingimfydrinek
dpfavkdgllile

Timeline for d3strp_:

• d3strp_ is new in SCOPe 2.01-stable
  
• d3strp_ appears in SCOPe 2.02
  
• d3strp_ appears in the current release, SCOPe 2.08