SCOPe 2.02: Domain d1cmza_: 1cmz A:

Lineage for d1cmza_ (1cmz A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein Galpha interacting protein, GaIP [48103] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48104] (1 PDB entry)

8. Domain d1cmza_: 1cmz A: [18547]

Details for d1cmza_

PDB Entry: 1cmz

PDB Description: solution structure of gaip (galpha interacting protein): a regulator of g protein signaling

PDB Compounds: (A:) protein (gaip (g-alpha interacting) protein)

SCOPe Domain Sequences for d1cmza_:

Sequence; same for both SEQRES and ATOM records:

>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]}
pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek
arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls
sptyrall

Timeline for d1cmza_:

• d1cmza_ first appeared (with stable ids) in SCOP 1.55
  
• d1cmza_ appears in SCOPe 2.01
  
• d1cmza_ appears in SCOPe 2.03
  
• d1cmza_ appears in the current release, SCOPe 2.08