SCOPe 2.02: Structural Classification of Proteins

PDB entry 1cmz

View 1cmz on RCSB PDB site
Description: solution structure of gaip (galpha interacting protein): a regulator of g protein signaling
Class: signaling protein regulation
Keywords: gaip, rgs, regulator of g protein, signaling protein regulation
Deposited on 1999-05-12, released 1999-11-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: protein (gaip (g-alpha interacting) protein)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P49795
Domains in SCOPe 2.02: d1cmza_

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1cmzA (A:)
spgisgggggipspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelk
aeanqhvvdekarliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytl
mhrdsyprflssptyrallpwvdsssslihrd

Sequence, based on observed residues (ATOM records): (download)

>1cmzA (A:)
pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek
arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls
sptyrall