Class a: All alpha proteins [46456] (290 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins) |
Protein Galpha interacting protein, GaIP [48103] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48104] (1 PDB entry) |
Domain d1cmza_: 1cmz A: [18547] |
PDB Entry: 1cmz (more details)
SCOPe Domain Sequences for d1cmza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]} pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls sptyrall
Timeline for d1cmza_: