Lineage for d1mrod1 (1mro D:270-549)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275095Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 1275096Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 1275097Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
    C-terminal domain is all-alpha
  6. 1275098Protein Alpha chain [48083] (3 species)
  7. 1275099Species Methanobacterium thermoautotrophicum [TaxId:145262] [48084] (11 PDB entries)
  8. 1275103Domain d1mrod1: 1mro D:270-549 [18526]
    Other proteins in same PDB: d1mroa2, d1mrob1, d1mrob2, d1mroc_, d1mrod2, d1mroe1, d1mroe2, d1mrof_
    complexed with com, f43, gol, na, tp7, zn

Details for d1mrod1

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (D:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mrod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrod1 a.89.1.1 (D:270-549) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
rrargenepggvpfgyladicqssrvnyedpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapnnmdtvldvatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d1mrod1:

Click to download the PDB-style file with coordinates for d1mrod1.
(The format of our PDB-style files is described here.)

Timeline for d1mrod1: