| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein) automatically mapped to Pfam PF02240 |
| Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (12 PDB entries) |
| Domain d1mrof_: 1mro F: [39438] Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mrob2, d1mrod1, d1mrod2, d1mroe1, d1mroe2 complexed with com, f43, gol, na, tp7, zn |
PDB Entry: 1mro (more details), 1.16 Å
SCOPe Domain Sequences for d1mrof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrof_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl
Timeline for d1mrof_: