SCOPe 2.03: Domain d1mrob2: 1mro B:2-188

Lineage for d1mrob2 (1mro B:2-188)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)

each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
C-terminal domain is all-alpha
Protein Beta chain [55099] (3 species)
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55100] (11 PDB entries)
Domain d1mrob2: 1mro B:2-188 [39449]
Other proteins in same PDB: d1mroa1, d1mroa2, d1mrob1, d1mroc_, d1mrod1, d1mrod2, d1mroe1, d1mrof_
complexed with com, f43, gol, na, tp7, zn

Details for d1mrob2

PDB Entry: 1mro (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase

PDB Compounds: (B:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d1mrob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrob2 d.58.31.2 (B:2-188) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
akfedkvdlyddrgnlveeqvplealsplrnpaiksivqgikrtvavnlegienalktak
vggpackimgreldldivgnaesiaaaakemiqvtedddtnvellgggkralvqvpsarf
dvaaeysaaplvtatafvqaiinefdvsmydanmvkaavlgrypqsveymganiatmldi
pqklegp

SCOPe Domain Coordinates for d1mrob2:

Click to download the PDB-style file with coordinates for d1mrob2.
(The format of our PDB-style files is described here.)

Timeline for d1mrob2: