SCOPe 2.04: Domain d3rymd_: 3rym D:

Lineage for d3rymd_ (3rym D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
   Uniprot P22364

8. Domain d3rymd_: 3rym D: [185213]
   automated match to d1aaca_
   complexed with zn; mutant

Details for d3rymd_

PDB Entry: 3rym, 1.7 Å

PDB Description: Structure of Oxidized M98K mutant of Amicyanin

PDB Compounds: (D:) amicyanin

SCOPe Domain Sequences for d3rymd_:

Sequence; same for both SEQRES and ATOM records:

>d3rymd_ b.6.1.1 (D:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve

Timeline for d3rymd_:

• d3rymd_ first appeared in SCOPe 2.01
  
• d3rymd_ appears in SCOPe 2.03
  
• d3rymd_ appears in SCOPe 2.05
  
• d3rymd_ appears in the current release, SCOPe 2.08