PDB entry 3rym

View 3rym on RCSB PDB site
Description: Structure of Oxidized M98K mutant of Amicyanin
Class: electron transport
Keywords: Type I Blue Copper Protein, Beta Sandwich, Electron Transport, metal binding
Deposited on 2011-05-11, released 2011-11-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (97)
    Domains in SCOPe 2.04: d3ryma_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (97)
    Domains in SCOPe 2.04: d3rymb_
  • Chain 'C':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (97)
    Domains in SCOPe 2.04: d3rymc_
  • Chain 'D':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: ami, mauC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered mutation (97)
    Domains in SCOPe 2.04: d3rymd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rymA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rymB (B:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rymC (C:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3rymD (D:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfkrgkvvve