SCOPe 2.01: Domain d3rnfa_: 3rnf A:

Lineage for d3rnfa_ (3rnf A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species)
   contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)

7. Species Pseudomonas sp. [TaxId:320855] [189497] (10 PDB entries)

8. Domain d3rnfa_: 3rnf A: [185056]
   Other proteins in same PDB: d3rnfb_, d3rnfc_
   automated match to d1t0qa_
   complexed with 1pe, edo, fe; mutant

Details for d3rnfa_

PDB Entry: 3rnf, 2.2 Å

PDB Description: structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant

PDB Compounds: (A:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnfa_:

Sequence; same for both SEQRES and ATOM records:

>d3rnfa_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas sp. [TaxId: 320855]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgfsnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsaltgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

Timeline for d3rnfa_:

• d3rnfa_ is new in SCOPe 2.01-stable
  
• d3rnfa_ appears in SCOPe 2.02
  
• d3rnfa_ appears in the current release, SCOPe 2.08