Lineage for d3rnfc_ (3rnf C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1019197Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1019198Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 1019199Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 1019200Species Pseudomonas sp. [TaxId:320855] [189499] (10 PDB entries)
  8. 1019202Domain d3rnfc_: 3rnf C: [185058]
    Other proteins in same PDB: d3rnfa_, d3rnfb_
    automated match to d1t0rc_
    complexed with 1pe, edo, fe; mutant

Details for d3rnfc_

PDB Entry: 3rnf (more details), 2.2 Å

PDB Description: structure of the toluene/o-xylene monooxygenase hydroxylase t201s/v271a double mutant
PDB Compounds: (C:) Toluene o-xylene monooxygenase component

SCOPe Domain Sequences for d3rnfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnfc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas sp. [TaxId: 320855]}
atfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtl
fprgmivsdaglrptetldiifmdn

SCOPe Domain Coordinates for d3rnfc_:

Click to download the PDB-style file with coordinates for d3rnfc_.
(The format of our PDB-style files is described here.)

Timeline for d3rnfc_: