SCOPe 2.08: Domain d3rgha1: 3rgh A:158-252

Lineage for d3rgha1 (3rgh A:158-252)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries)

8. Domain d3rgha1: 3rgh A:158-252 [184950]
   Other proteins in same PDB: d3rgha2, d3rghb2
   automated match to d2diaa1
   complexed with act

Details for d3rgha1

PDB Entry: 3rgh, 2.44 Å

PDB Description: Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d3rgha1:

Sequence; same for both SEQRES and ATOM records:

>d3rgha1 b.1.18.0 (A:158-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgdgth
tityiplcpgaytvtikyggqpvpnfpsklqvepa

Timeline for d3rgha1:

• d3rgha1 first appeared in SCOPe 2.01, called d3rgha_
  
• d3rgha1 appears in SCOPe 2.07