| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186988] (11 PDB entries) |
| Domain d3rghb1: 3rgh B:158-252 [184951] Other proteins in same PDB: d3rgha2, d3rghb2 automated match to d2diaa1 complexed with act |
PDB Entry: 3rgh (more details), 2.44 Å
SCOPe Domain Sequences for d3rghb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rghb1 b.1.18.0 (B:158-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fdaskvkcsgpgleratagevgqfqvdcssagsaeltieicseaglpaevyiqdhgdgth
tityiplcpgaytvtikyggqpvpnfpsklqvepa
Timeline for d3rghb1: