Lineage for d3rdhb_ (3rdh B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1096148Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 1096149Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1096164Protein zeta isoform [48449] (2 species)
  7. 1096174Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries)
  8. 1096186Domain d3rdhb_: 3rdh B: [184887]
    automated match to d1qjba_
    complexed with 3rd, ni

Details for d3rdhb_

PDB Entry: 3rdh (more details), 2.39 Å

PDB Description: X-ray induced covalent inhibition of 14-3-3
PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3rdhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdhb_ a.118.7.1 (B:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
gshmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrs
swrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvf
ylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvf
yyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d3rdhb_:

Click to download the PDB-style file with coordinates for d3rdhb_.
(The format of our PDB-style files is described here.)

Timeline for d3rdhb_: