SCOPe 2.08: Domain d3rdhb1: 3rdh B:1-230

Lineage for d3rdhb1 (3rdh B:1-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein zeta isoform [48449] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48451] (13 PDB entries)

8. Domain d3rdhb1: 3rdh B:1-230 [184887]
   Other proteins in same PDB: d3rdha2, d3rdhb2, d3rdhc2, d3rdhd2
   automated match to d1qjba_
   complexed with 3rd, ni

Details for d3rdhb1

PDB Entry: 3rdh, 2.39 Å

PDB Description: X-ray induced covalent inhibition of 14-3-3

PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3rdhb1:

Sequence; same for both SEQRES and ATOM records:

>d3rdhb1 a.118.7.1 (B:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Timeline for d3rdhb1:

• d3rdhb1 first appeared in SCOPe 2.01, called d3rdhb_
  
• d3rdhb1 appears in SCOPe 2.07