SCOPe 2.02: Domain d3rdhd_: 3rdh D:

Lineage for d3rdhd_ (3rdh D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein zeta isoform [48449] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries)

8. Domain d3rdhd_: 3rdh D: [184889]
   automated match to d1qjba_
   complexed with 3rd, ni

Details for d3rdhd_

PDB Entry: 3rdh, 2.39 Å

PDB Description: X-ray induced covalent inhibition of 14-3-3

PDB Compounds: (D:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d3rdhd_:

Sequence; same for both SEQRES and ATOM records:

>d3rdhd_ a.118.7.1 (D:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
gshmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrs
swrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvf
ylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvf
yyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Timeline for d3rdhd_:

• d3rdhd_ first appeared in SCOPe 2.01
  
• d3rdhd_ appears in SCOPe 2.03
  
• d3rdhd_ appears in the current release, SCOPe 2.08, called d3rdhd1