SCOPe 2.06: Domain d3r0ld_: 3r0l D:

Lineage for d3r0ld_ (3r0l D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Crotalus durissus [TaxId:8732] [188410] (2 PDB entries)

8. Domain d3r0ld_: 3r0l D: [184756]
   automated match to d1bjja_
   complexed with act, cl, mn, na

Details for d3r0ld_

PDB Entry: 3r0l, 1.35 Å

PDB Description: crystal structure of crotoxin

PDB Compounds: (D:) Phospholipase A2 CB

SCOPe Domain Sequences for d3r0ld_:

Sequence; same for both SEQRES and ATOM records:

>d3r0ld_ a.133.1.2 (D:) automated matches {Crotalus durissus [TaxId: 8732]}
hllqfnkmikfetrknavpfyafygcycgwggqgrpkdatdrccfvhdccygklakcntk
wdiyryslksgyitcgkgtwceeqicecdrvaaeclrrslstykngymfypdsrcrgpse
tc

Timeline for d3r0ld_:

• d3r0ld_ first appeared in SCOPe 2.01
  
• d3r0ld_ appears in SCOPe 2.05
  
• d3r0ld_ appears in SCOPe 2.07
  
• d3r0ld_ appears in the current release, SCOPe 2.08