Lineage for d3r0ld_ (3r0l D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733362Species Crotalus durissus [TaxId:8732] [188410] (3 PDB entries)
  8. 2733363Domain d3r0ld_: 3r0l D: [184756]
    automated match to d1bjja_
    complexed with act, cl, mn, na

Details for d3r0ld_

PDB Entry: 3r0l (more details), 1.35 Å

PDB Description: crystal structure of crotoxin
PDB Compounds: (D:) Phospholipase A2 CB

SCOPe Domain Sequences for d3r0ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0ld_ a.133.1.2 (D:) automated matches {Crotalus durissus [TaxId: 8732]}
hllqfnkmikfetrknavpfyafygcycgwggqgrpkdatdrccfvhdccygklakcntk
wdiyryslksgyitcgkgtwceeqicecdrvaaeclrrslstykngymfypdsrcrgpse
tc

SCOPe Domain Coordinates for d3r0ld_:

Click to download the PDB-style file with coordinates for d3r0ld_.
(The format of our PDB-style files is described here.)

Timeline for d3r0ld_: