SCOPe 2.08: Domain d1qc7a_: 1qc7 A:

Lineage for d1qc7a_ (1qc7 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.14: FliG [48029] (2 families)
   fragmented superhelix; consist of 3/4-helical motifs and connecting helices

5. Family a.118.14.1: FliG [48030] (2 proteins)

6. Protein FliG [48031] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [48032] (3 PDB entries)

8. Domain d1qc7a_: 1qc7 A: [18456]
   C-terminal domain only
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1qc7a_

PDB Entry: 1qc7, 2.2 Å

PDB Description: t. maritima flig c-terminal domain

PDB Compounds: (A:) protein (flig)

SCOPe Domain Sequences for d1qc7a_:

Sequence; same for both SEQRES and ATOM records:

>d1qc7a_ a.118.14.1 (A:) FliG {Thermotoga maritima [TaxId: 2336]}
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiviargggeelim

Timeline for d1qc7a_:

• d1qc7a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qc7a_ appears in SCOPe 2.07