| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.14: FliG [48029] (2 families) ![]() fragmented superhelix; consist of 3/4-helical motifs and connecting helices |
| Family a.118.14.1: FliG [48030] (2 proteins) |
| Protein FliG [48031] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [48032] (3 PDB entries) |
| Domain d1qc7a_: 1qc7 A: [18456] C-terminal domain only fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1qc7 (more details), 2.2 Å
SCOPe Domain Sequences for d1qc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qc7a_ a.118.14.1 (A:) FliG {Thermotoga maritima [TaxId: 2336]}
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiviargggeelim
Timeline for d1qc7a_: