PDB entry 1qc7

View 1qc7 on RCSB PDB site
Description: t. maritima flig c-terminal domain
Class: structural protein
Keywords: flagellar motor switch protein, structural protein
Deposited on 1999-05-18, released 1999-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (flig)
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FLIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qc7a_
  • Chain 'B':
    Compound: protein (flig)
    Species: Thermotoga maritima [TaxId:2336]
    Gene: FLIG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qc7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qc7A (A:)
    mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
    mgpvrlkdveeaqqkiiniirrleeageiviargggeelim
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qc7B (B:)
    mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
    mgpvrlkdveeaqqkiiniirrleeageiviargggeelim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qc7B (B:)
    mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
    mgpvrlkdveeaqqkiiniirrleeageiv