SCOPe 2.07: Domain d3qlzb1: 3qlz B:3-217

Lineage for d3qlzb1 (3qlz B:3-217)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)

8. Domain d3qlzb1: 3qlz B:3-217 [184487]
   Other proteins in same PDB: d3qlza2, d3qlzb2
   automated match to d1ai9a_
   complexed with mg, ndp, qlz

Details for d3qlzb1

PDB Entry: 3qlz, 1.94 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-[3-(2,5-dimethoxyphenyl)prop-1-yn-1-yl]-6-propylpyrimidine-2,4-diamine (UCP130B)

PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3qlzb1:

Sequence; same for both SEQRES and ATOM records:

>d3qlzb1 c.71.1.0 (B:3-217) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d3qlzb1:

• d3qlzb1 first appeared in SCOPe 2.01, called d3qlzb_
  
• d3qlzb1 appears in SCOPe 2.06
  
• d3qlzb1 appears in the current release, SCOPe 2.08