Lineage for d3qlzb1 (3qlz B:3-217)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904135Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)
  8. 2904137Domain d3qlzb1: 3qlz B:3-217 [184487]
    Other proteins in same PDB: d3qlza2, d3qlzb2
    automated match to d1ai9a_
    complexed with mg, ndp, qlz

Details for d3qlzb1

PDB Entry: 3qlz (more details), 1.94 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-[3-(2,5-dimethoxyphenyl)prop-1-yn-1-yl]-6-propylpyrimidine-2,4-diamine (UCP130B)
PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3qlzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlzb1 c.71.1.0 (B:3-217) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

SCOPe Domain Coordinates for d3qlzb1:

Click to download the PDB-style file with coordinates for d3qlzb1.
(The format of our PDB-style files is described here.)

Timeline for d3qlzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qlzb2