SCOPe 2.01: Domain d3qlzb_: 3qlz B:

Lineage for d3qlzb_ (3qlz B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (8 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)

8. Domain d3qlzb_: 3qlz B: [184487]
   automated match to d1ai9a_
   complexed with mg, nap, qlz

Details for d3qlzb_

PDB Entry: 3qlz, 1.94 Å

PDB Description: Candida glabrata dihydrofolate reductase complexed with NADPH and 5-[3-(2,5-dimethoxyphenyl)prop-1-yn-1-yl]-6-propylpyrimidine-2,4-diamine (UCP130B)

PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3qlzb_:

Sequence; same for both SEQRES and ATOM records:

>d3qlzb_ c.71.1.0 (B:) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3qlzb_:

• d3qlzb_ is new in SCOPe 2.01-stable
  
• d3qlzb_ appears in SCOPe 2.02
  
• d3qlzb_ appears in the current release, SCOPe 2.08, called d3qlzb1