Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) |
Family c.34.1.0: automated matches [191535] (1 protein) not a true family |
Protein automated matches [190910] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [189637] (1 PDB entry) |
Domain d3qjgc_: 3qjg C: [184430] automated match to d1g63a_ complexed with cl, fmn |
PDB Entry: 3qjg (more details), 2.04 Å
SCOPe Domain Sequences for d3qjgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qjgc_ c.34.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]} envliclcgsvnsinishyiielkskfdevnviastngrkfingeilkqfcdnyydefed pflnhvdiankhdkiiilpatsntinkiangicdnllltichtafeklsifpnmnlrmwe npvtqnnirllkdygvsiypanisesyelasktfkknvvapepykvlefi
Timeline for d3qjgc_: