Lineage for d3qjgc_ (3qjg C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864431Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864432Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2864471Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2864472Protein automated matches [190910] (10 species)
    not a true protein
  7. 2864524Species Staphylococcus aureus [TaxId:93062] [189637] (1 PDB entry)
  8. 2864527Domain d3qjgc_: 3qjg C: [184430]
    automated match to d1g63a_
    complexed with cl, fmn

Details for d3qjgc_

PDB Entry: 3qjg (more details), 2.04 Å

PDB Description: epidermin biosynthesis protein epid from staphylococcus aureus
PDB Compounds: (C:) Epidermin biosynthesis protein EpiD

SCOPe Domain Sequences for d3qjgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjgc_ c.34.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 93062]}
envliclcgsvnsinishyiielkskfdevnviastngrkfingeilkqfcdnyydefed
pflnhvdiankhdkiiilpatsntinkiangicdnllltichtafeklsifpnmnlrmwe
npvtqnnirllkdygvsiypanisesyelasktfkknvvapepykvlefi

SCOPe Domain Coordinates for d3qjgc_:

Click to download the PDB-style file with coordinates for d3qjgc_.
(The format of our PDB-style files is described here.)

Timeline for d3qjgc_: