Lineage for d3qjgf_ (3qjg F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472664Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472665Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2472704Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2472705Protein automated matches [190910] (9 species)
    not a true protein
  7. 2472757Species Staphylococcus aureus [TaxId:93062] [189637] (1 PDB entry)
  8. 2472763Domain d3qjgf_: 3qjg F: [184433]
    automated match to d1g63a_
    complexed with cl, fmn

Details for d3qjgf_

PDB Entry: 3qjg (more details), 2.04 Å

PDB Description: epidermin biosynthesis protein epid from staphylococcus aureus
PDB Compounds: (F:) Epidermin biosynthesis protein EpiD

SCOPe Domain Sequences for d3qjgf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjgf_ c.34.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 93062]}
envliclcgsvnsinishyiielkskfdevnviastngrkfingeilkqfcdnyydefed
pflnhvdiankhdkiiilpatsntinkiangicdnllltichtafeklsifpnmnlrmwe
npvtqnnirllkdygvsiypanisesyelasktfkknvvapepykvlefi

SCOPe Domain Coordinates for d3qjgf_:

Click to download the PDB-style file with coordinates for d3qjgf_.
(The format of our PDB-style files is described here.)

Timeline for d3qjgf_: