Lineage for d1hw1b2 (1hw1 B:79-230)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445535Fold a.78: Fatty acid responsive transcription factor FadR, C-terminal domain [48007] (1 superfamily)
    core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 445536Superfamily a.78.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48008] (1 family) (S)
  5. 445537Family a.78.1.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48009] (1 protein)
  6. 445538Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)
  7. 445539Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)
  8. 445541Domain d1hw1b2: 1hw1 B:79-230 [18442]
    Other proteins in same PDB: d1hw1a1, d1hw1b1

Details for d1hw1b2

PDB Entry: 1hw1 (more details), 1.5 Å

PDB Description: the fadr-dna complex: transcriptional control of fatty acid metabolism in escherichia coli

SCOP Domain Sequences for d1hw1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw1b2 a.78.1.1 (B:79-230) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqknl

SCOP Domain Coordinates for d1hw1b2:

Click to download the PDB-style file with coordinates for d1hw1b2.
(The format of our PDB-style files is described here.)

Timeline for d1hw1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw1b1