SCOPe 2.08: Domain d1hw1b2: 1hw1 B:79-230

Lineage for d1hw1b2 (1hw1 B:79-230)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
   core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family)

5. Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 proteins)

6. Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)

7. Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)

8. Domain d1hw1b2: 1hw1 B:79-230 [18442]
   Other proteins in same PDB: d1hw1a1, d1hw1b1
   protein/DNA complex; complexed with so4, zn

Details for d1hw1b2

PDB Entry: 1hw1, 1.5 Å

PDB Description: the fadr-dna complex: transcriptional control of fatty acid metabolism in escherichia coli

PDB Compounds: (B:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1hw1b2:

Sequence; same for both SEQRES and ATOM records:

>d1hw1b2 a.78.1.1 (B:79-230) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqknl

Timeline for d1hw1b2:

• d1hw1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1hw1b2 appears in SCOPe 2.07