Lineage for d1hw1a1 (1hw1 A:5-78)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438620Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein)
  6. 438621Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)
  7. 438622Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)
  8. 438623Domain d1hw1a1: 1hw1 A:5-78 [16111]
    Other proteins in same PDB: d1hw1a2, d1hw1b2

Details for d1hw1a1

PDB Entry: 1hw1 (more details), 1.5 Å

PDB Description: the fadr-dna complex: transcriptional control of fatty acid metabolism in escherichia coli

SCOP Domain Sequences for d1hw1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli}
aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
hgkptkvnnfwets

SCOP Domain Coordinates for d1hw1a1:

Click to download the PDB-style file with coordinates for d1hw1a1.
(The format of our PDB-style files is described here.)

Timeline for d1hw1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw1a2