SCOP 1.55: Domain d1hw1b2: 1hw1 B:79-230

Lineage for d1hw1b2 (1hw1 B:79-230)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.78: Fatty acid responsive transcription factor FadR, C-terminal domain [48007] (1 superfamily)

4. Superfamily a.78.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48008] (1 family)

5. Family a.78.1.1: Fatty acid responsive transcription factor FadR, C-terminal domain [48009] (1 protein)

6. Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)

7. Species Escherichia coli [TaxId:562] [48011] (3 PDB entries)

8. Domain d1hw1b2: 1hw1 B:79-230 [18442]
   Other proteins in same PDB: d1hw1a1, d1hw1b1

Details for d1hw1b2

PDB Entry: 1hw1, 1.5 Å

PDB Description: the fadr-dna complex: transcriptional control of fatty acid metabolism in escherichia coli

SCOP Domain Sequences for d1hw1b2:

Sequence; same for both SEQRES and ATOM records:

>d1hw1b2 a.78.1.1 (B:79-230) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqknl

Timeline for d1hw1b2:

• d1hw1b2 appears in SCOP 1.57
  
• d1hw1b2 appears in the current release, SCOPe 2.08