SCOPe 2.07: Domain d3q2pd_: 3q2p D:

Lineage for d3q2pd_ (3q2p D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (2 proteins)

6. Protein automated matches [190339] (1 species)
   not a true protein

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (12 PDB entries)

8. Domain d3q2pd_: 3q2p D: [184175]
   automated match to d1m9ga_
   complexed with na; mutant

Details for d3q2pd_

PDB Entry: 3q2p, 2.34 Å

PDB Description: reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix

PDB Compounds: (D:) Monellin chain B/Monellin chain A chimeric protein

SCOPe Domain Sequences for d3q2pd_:

Sequence; same for both SEQRES and ATOM records:

>d3q2pd_ d.17.1.1 (D:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlakfavdeenkigqygrltfnkairpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d3q2pd_:

• d3q2pd_ first appeared in SCOPe 2.01
  
• d3q2pd_ appears in SCOPe 2.06
  
• d3q2pd_ appears in the current release, SCOPe 2.08