Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.1: Monellin [54404] (2 proteins) |
Protein automated matches [190339] (1 species) not a true protein |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries) |
Domain d3q2pd_: 3q2p D: [184175] automated match to d1m9ga_ complexed with na; mutant |
PDB Entry: 3q2p (more details), 2.34 Å
SCOPe Domain Sequences for d3q2pd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q2pd_ d.17.1.1 (D:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlakfavdeenkigqygrltfnkairpcmkktiyenegfreikgyey qlyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d3q2pd_: