Class a: All alpha proteins [46456] (290 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) automatically mapped to Pfam PF02742 |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries) Uniprot P33120 |
Domain d1bi3b2: 1bi3 B:65-140 [18406] Other proteins in same PDB: d1bi3a1, d1bi3a3, d1bi3b1 complexed with so4, zn |
PDB Entry: 1bi3 (more details), 2.4 Å
SCOPe Domain Sequences for d1bi3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi3b2 a.76.1.1 (B:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs rspfgnpipgldelgv
Timeline for d1bi3b2: