PDB entry 1bi3

View 1bi3 on RCSB PDB site
Description: structure of apo-and holo-diphtheria toxin repressor
Class: repressor
Keywords: repressor, transcription regulation, DNA-binding, iron
Deposited on 1998-06-21, released 1999-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • modified (101)
    Domains in SCOPe 2.07: d1bi3a1, d1bi3a2, d1bi3a3
  • Chain 'B':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Gene: DTXR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • modified (101)
    Domains in SCOPe 2.07: d1bi3b1, d1bi3b2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bi3A (A:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi3A (A:)
    lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
    mtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdv
    srspfgnpipgldelgvpgtrvidaatsmprkvrivqineifqvetdqftqlldadirvg
    seveivdhitlshngkdvellddlahtiriee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bi3B (B:)
    mkdlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bi3B (B:)
    lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
    mtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdv
    srspfgnpipgldelgv