Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (4 species) not a true protein |
Species Escherichia coli [TaxId:511145] [189613] (6 PDB entries) |
Domain d3pvyb_: 3pvy B: [184023] automated match to d1otka_ complexed with coa, gol |
PDB Entry: 3pvy (more details), 2.15 Å
SCOPe Domain Sequences for d3pvyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvyb_ a.25.1.2 (B:) automated matches {Escherichia coli [TaxId: 511145]} snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy
Timeline for d3pvyb_: