SCOPe 2.08: Domain d3pvyb1: 3pvy B:2-238

Lineage for d3pvyb1 (3pvy B:2-238)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)

8. Domain d3pvyb1: 3pvy B:2-238 [184023]
   Other proteins in same PDB: d3pvyb2, d3pvyc2
   automated match to d1otka_
   complexed with coa, gol

Details for d3pvyb1

PDB Entry: 3pvy, 2.15 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with coenzyme A

PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pvyb1:

Sequence; same for both SEQRES and ATOM records:

>d3pvyb1 a.25.1.2 (B:2-238) automated matches {Escherichia coli [TaxId: 511145]}
nqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaelag
egdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqlaa
isakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidialse
egiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqy

Timeline for d3pvyb1:

• d3pvyb1 first appeared in SCOPe 2.01, called d3pvyb_
  
• d3pvyb1 appears in SCOPe 2.07