SCOPe 2.04: Domain d3pvtb_: 3pvt B:

Lineage for d3pvtb_ (3pvt B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries)

8. Domain d3pvtb_: 3pvt B: [184017]
   automated match to d1otka_
   complexed with 3hc, gol

Details for d3pvtb_

PDB Entry: 3pvt, 2.03 Å

PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA

PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOPe Domain Sequences for d3pvtb_:

Sequence; same for both SEQRES and ATOM records:

>d3pvtb_ a.25.1.2 (B:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemq

Timeline for d3pvtb_:

• d3pvtb_ first appeared in SCOPe 2.01
  
• d3pvtb_ appears in SCOPe 2.03
  
• d3pvtb_ appears in SCOPe 2.05
  
• d3pvtb_ appears in the current release, SCOPe 2.08, called d3pvtb1